Dedicated domain for location based service pages?
- SEO |
Although I haven't posted here yet, I frequent these boards for SEO insight. I was hoping somebody could provide some insight into a new project I'm about to undertake.
I have a client who is looking to start a new wildlife services business in the Pennsylvania Tri-State area. I'll be designing the website, as well as performing SEO administration. I want to create dedicated, location based pages for each type of service they provide. I'm looking to have pages dedicated to Pennsylvania, New Jersey and Delaware for each service they provide. These pages will fall under the umbrella of their main website, for which this example I will call wildlifeservices.com
My question to you is, how would you recommend setting up the URL structure for this? Should I have a location based sub-domain for each state (ex: pa.wildlifeservices.com), or would it be better to have a primary domain that included the location modifier for each state (pennsylvaniawildlifeservices.com / pawildlifeservices.com) that points to a directory housing all of the state relevant pages I want to fall under it?
I feel like I'm overthinking this, so I'd appreciate any quality advice for how to go about this. I definitely want to have pages optimized for each state I mentioned above, but I'm not 100% sure how I should go about setting up the domains/URL's. I'm concerned about duplicate content penatlties, and if there is anything else I should be weary of in this situation, please advise.
Thanks all!